PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MLOC_57709.3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
Family HSF
Protein Properties Length: 96aa    MW: 10478.9 Da    PI: 9.9654
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MLOC_57709.3genomeIBSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind72.29.8e-233088260
                  HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHT CS
  HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmY 60
                  Fl+k+++++e++ ++e+isw e+g+sfvv+++ e+a+++Lp +Fkh nf+SFvRQLn+Y
  MLOC_57709.3 30 FLTKTHQMVEERGTDEVISWGEHGRSFVVWKPVELARDLLPLHFKHCNFSSFVRQLNTY 88
                  9*********************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.9E-252588IPR011991Winged helix-turn-helix DNA-binding domain
SuperFamilySSF467856.53E-212688IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004152.5E-192694IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.9E-133053IPR000232Heat shock factor (HSF)-type, DNA-binding
PfamPF004474.4E-193088IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.9E-136880IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000565.9E-138193IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009408Biological Processresponse to heat
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 96 aa     Download sequence    Send to blast
MAGAAAAQQQ QQKGGGGVVM KGGGGGPAPF LTKTHQMVEE RGTDEVISWG EHGRSFVVWK  60
PVELARDLLP LHFKHCNFSS FVRQLNTYVR NHPPPN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1hks_A4e-152388165HEAT-SHOCK TRANSCRIPTION FACTOR
1hkt_A4e-152388165HEAT-SHOCK TRANSCRIPTION FACTOR
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3657391e-157AK365739.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2037B11.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001150318.15e-42heat shock factor protein 4
SwissprotQ67TP95e-37HSFB1_ORYSJ; Heat stress transcription factor B-1
TrEMBLM0X7S94e-67M0X7S9_HORVD; Uncharacterized protein
STRINGMLOC_57709.12e-58(Hordeum vulgare)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36990.12e-27heat shock factor 4